Protein Info for Shewana3_0011 in Shewanella sp. ANA-3

Name: recF
Annotation: recombination protein F (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 PF13175: AAA_15" amino acids 1 to 75 (75 residues), 32.4 bits, see alignment E=2e-11 TIGR00611: DNA replication and repair protein RecF" amino acids 1 to 355 (355 residues), 346.4 bits, see alignment E=1.1e-107 PF02463: SMC_N" amino acids 3 to 340 (338 residues), 123.2 bits, see alignment E=2.7e-39 PF13514: AAA_27" amino acids 5 to 126 (122 residues), 24.5 bits, see alignment E=4.8e-09 PF13476: AAA_23" amino acids 5 to 104 (100 residues), 44.7 bits, see alignment E=6.5e-15 PF13304: AAA_21" amino acids 25 to 330 (306 residues), 30.5 bits, see alignment E=1e-10

Best Hits

Swiss-Prot: 100% identical to RECF_SHESA: DNA replication and repair protein RecF (recF) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K03629, DNA replication and repair protein RecF (inferred from 99% identity to shm:Shewmr7_0003)

Predicted SEED Role

"DNA recombination and repair protein RecF" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KR37 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Shewana3_0011 recombination protein F (RefSeq) (Shewanella sp. ANA-3)
MSLIRLNIDSFRNIQLAQLSPSSGINLIYGQNGSGKTSILEAIYFLGMGRSFRSHLSQRV
INNEQDKLTLFATLNLPRGDSKIGLRRFRSGETEVKIDGEKVKRLSTLAETLPIQVITPE
SFSLLFEGPKSRRQFIDWGAFHSDPQFYAAWVNVRRVLKQRNQLLRNNSSYDQIQYWDRE
FVRYTEQVTEIRNRYVDSLNELLKGIIGEFLPQVDVKVSFTRGWDSKTDFAQLLESQYPR
DLATGHTVSGPHKADLRLRVGSLPAQDAMSRGQLKLLVCALRIAQGKLLKQQIDKHSIYL
VDDLPSELDAQHRQLLLKQLVDTGAQVFVTAIEPAAIVDSLHMPPSRMFHVEQGRVTVIE