Protein Info for Shewana3_0009 in Shewanella sp. ANA-3

Name: dnaA
Annotation: chromosomal replication initiation protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 PF11638: DnaA_N" amino acids 4 to 64 (61 residues), 71 bits, see alignment E=1.6e-23 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 6 to 458 (453 residues), 622.7 bits, see alignment E=2e-191 PF00308: Bac_DnaA" amino acids 126 to 285 (160 residues), 243.7 bits, see alignment E=3.1e-76 PF01695: IstB_IS21" amino acids 161 to 263 (103 residues), 28 bits, see alignment E=4.8e-10 PF00004: AAA" amino acids 162 to 265 (104 residues), 27.2 bits, see alignment E=1.4e-09 PF22688: Hda_lid" amino acids 294 to 356 (63 residues), 34.4 bits, see alignment E=5.4e-12 PF08299: Bac_DnaA_C" amino acids 369 to 437 (69 residues), 111.9 bits, see alignment E=3.6e-36

Best Hits

Swiss-Prot: 100% identical to DNAA_SHESA: Chromosomal replication initiator protein DnaA (dnaA) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 99% identity to son:SO_0008)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KR35 at UniProt or InterPro

Protein Sequence (460 amino acids)

>Shewana3_0009 chromosomal replication initiation protein (RefSeq) (Shewanella sp. ANA-3)
MAVSLWQQCIGRLQDELSAQQFSMWIRPLQAEMDGDTLVLYAPNRFVLDWVRDKYINIIN
QFFTEQMGNDAPKLRFDIGSRPSAKKPEPAPVAAVRVPNPQTKASVGTSFNTTEPVANAN
HRSNINPTYQFDNFVEGKSNQLGKAAALQVAENPGGAYNPLFLYGGTGLGKTHLLHAVGN
GIIKNNPDAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALFIDDIQFFANKDRSQ
EEFFHTFNALLEGNHQIILTSDRYPKEIDGVEDRLKSRFGWGLTVAIEPPELETRVAILM
RKAQESGINLPDEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLL
ALQEKLVTIDNIQKTVAEYYKIKMADMLSKRRSRSVARPRQVAMALSKELTNQSLPEIGD
AFGGRDHTTVLHACRKIAQLREESHDIKEDYANLIRTLSS