Protein Info for Shewana3_0006 in Shewanella sp. ANA-3

Annotation: protein translocase subunit yidC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 249 to 264 (16 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details amino acids 351 to 372 (22 residues), see Phobius details amino acids 418 to 439 (22 residues), see Phobius details amino acids 460 to 477 (18 residues), see Phobius details amino acids 497 to 519 (23 residues), see Phobius details TIGR03593: membrane protein insertase, YidC/Oxa1 family, N-terminal domain" amino acids 3 to 351 (349 residues), 378.8 bits, see alignment E=3.9e-117 PF14849: YidC_periplas" amino acids 68 to 342 (275 residues), 310 bits, see alignment E=2.4e-96 PF02096: 60KD_IMP" amino acids 346 to 534 (189 residues), 268 bits, see alignment E=4.9e-84 TIGR03592: membrane protein insertase, YidC/Oxa1 family" amino acids 352 to 532 (181 residues), 236.3 bits, see alignment E=3e-74

Best Hits

Swiss-Prot: 100% identical to YIDC_SHESA: Membrane protein insertase YidC (yidC) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K03217, preprotein translocase subunit YidC (inferred from 100% identity to shn:Shewana3_0006)

MetaCyc: 52% identical to membrane protein insertase YidC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-403

Predicted SEED Role

"Inner membrane protein translocase component YidC, long form"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KR32 at UniProt or InterPro

Protein Sequence (541 amino acids)

>Shewana3_0006 protein translocase subunit yidC (RefSeq) (Shewanella sp. ANA-3)
MESQRNILLIGLLFVSFLLWQQWQADKAPKPVATESSVVANATTNHSADVPEADTSVPAA
LTATQNLITVKTDQLDVQINPVGGDIVFAALVSHKLEQGKDQPFVLLEQTKDFTYIAQSG
LIGRDGIDSSAKGRAAFAANKTEFTLADGQDTLEVPLTYVADNGVTYTKVFVFHRGKFNV
DIDYKINNTSAAPLQVQMYGQIKQTIKPSESSMMMPTYRGAAFSTQDVRYEKYKFEDMSK
SNLNQPTLGGWAAMLQHYFVSAWIPPATDSNTIFSSVSAGGLANIGFRGAVYDIAPGATQ
EISSQFYVGPKDQKALSALSDTLNLVVDYGFLWWLAVPIHWLLMFYQSFVGNWGVAIILI
TLTVRGLLFPLTKAQYTSMAKMRNLQPKLQDLKERFGDDRQKMGQAMMELYKKEKVNPMG
GCLPILLQMPIFIALYWVLLESFELRHAPFMLWIHDLSVQDPYYILPLLMGASMFVMQKM
QPIAPTMDPMQVKMMQWMPMIFTVFFLWFPSGLVLYWLVGNIVAIIQQKIIYAGLEKKGL
K