Protein Info for Shewana3_4365 in Shewanella sp. ANA-3

Annotation: chromate transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 156 to 188 (33 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details amino acids 339 to 365 (27 residues), see Phobius details amino acids 380 to 402 (23 residues), see Phobius details amino acids 413 to 429 (17 residues), see Phobius details amino acids 435 to 454 (20 residues), see Phobius details PF02417: Chromate_transp" amino acids 22 to 187 (166 residues), 159.1 bits, see alignment E=5e-51 amino acids 262 to 447 (186 residues), 121.9 bits, see alignment E=1.4e-39 TIGR00937: chromate efflux transporter" amino acids 29 to 446 (418 residues), 236.4 bits, see alignment E=3.9e-74

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 100% identity to shn:Shewana3_4365)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L3E7 at UniProt or InterPro

Protein Sequence (455 amino acids)

>Shewana3_4365 chromate transporter (RefSeq) (Shewanella sp. ANA-3)
MSNTTELIAHQPVEAPAPVSFWEAFRFWLKLGFVSFGGPAGQIAIMHQELVERRRWISEK
RFLHALNYCMVLPGPEAQQLATYIGWLMHRTWGGIVAGVLFLLPSLFILIGLSWVYIAYG
DVSWVAGLFYGIKPAVTAIVVHAAHRIGSRALKNNVMWAIAAAAFVAIFALNIPFPYIVI
AAALIGYLGGRFLPDYFNSGGGHGKADKSFGTALFDDHTPTPAHAMFRWSRFSMILISGA
LLWAVPLFALWSYFGWDHTLTQMAWFFTKAALLTFGGAYAVLPYVYQGAVGHYGWLTPTQ
MIDGLALGETTPGPLIMVVAFVGFIGGYVQAVFGTDMVFLAGAVAATIVTWFTFLPSFIF
IFAGAPFIETTHNDLKFTAPLTAITAAVVGVILNLALFFCYHILWPEGFDGRFEWISAVI
AVAAGIALFRYKMNVMKVIGMSALVGLAVSLMGIN