Protein Info for Shewana3_4326 in Shewanella sp. ANA-3

Annotation: methionine sulfoxide reductase B (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 TIGR00357: methionine-R-sulfoxide reductase" amino acids 11 to 138 (128 residues), 193.4 bits, see alignment E=7.7e-62 PF01641: SelR" amino acids 14 to 129 (116 residues), 166.1 bits, see alignment E=1.4e-53

Best Hits

Swiss-Prot: 77% identical to MSRB_BRUSU: Peptide methionine sulfoxide reductase MsrB (msrB) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 100% identity to shn:Shewana3_4326)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.12

Use Curated BLAST to search for 1.8.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L3A8 at UniProt or InterPro

Protein Sequence (148 amino acids)

>Shewana3_4326 methionine sulfoxide reductase B (RefSeq) (Shewanella sp. ANA-3)
MNTYQKSMNAISALTKEQYRVTQENGTERPGTGELLKNTKPGIYVDIVSGEPLFASSAKY
ESGCGWPSFTKAIDSVNVIEITDRSHGMTRTEVRSTHGDSHLGHVFSDGPKDQGGLRYCI
NSASLRFIPREEMASKGYAEYLDQVEDI