Protein Info for Shewana3_4315 in Shewanella sp. ANA-3

Annotation: MerR family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 PF00376: MerR" amino acids 6 to 43 (38 residues), 43.4 bits, see alignment E=3.6e-15 PF13411: MerR_1" amino acids 6 to 72 (67 residues), 68.5 bits, see alignment E=6.7e-23 TIGR02051: Hg(II)-responsive transcriptional regulator" amino acids 6 to 128 (123 residues), 173.4 bits, see alignment E=1.1e-55 PF09278: MerR-DNA-bind" amino acids 48 to 109 (62 residues), 67.6 bits, see alignment E=1.7e-22

Best Hits

Swiss-Prot: 47% identical to MERR_PSEFL: Mercuric resistance operon regulatory protein (merR) from Pseudomonas fluorescens

KEGG orthology group: K08365, MerR family transcriptional regulator, mercuric resistance operon regulatory protein (inferred from 100% identity to shn:Shewana3_4315)

Predicted SEED Role

"Mercuric resistance operon regulatory protein" in subsystem Mercury resistance operon

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L399 at UniProt or InterPro

Protein Sequence (130 amino acids)

>Shewana3_4315 MerR family transcriptional regulator (RefSeq) (Shewanella sp. ANA-3)
MNMTRTISKVAKELAINIETVRFYERRGLIEQPPKPELGYRHYPDETVNRIRFIKRAQEL
GFTLEEIANLLSLNDRPCAQVQELAEYKLSAVMEKIADLKRLESALKALLTQCQSNNDDS
HCPIIDSLQP