Protein Info for Shewana3_4303 in Shewanella sp. ANA-3

Annotation: peptidase M23B (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF19425: Csd3_N2" amino acids 7 to 110 (104 residues), 45.9 bits, see alignment E=5.4e-16 PF01551: Peptidase_M23" amino acids 122 to 215 (94 residues), 92 bits, see alignment E=2.2e-30

Best Hits

KEGG orthology group: None (inferred from 99% identity to spc:Sputcn32_0266)

Predicted SEED Role

"Cell wall endopeptidase, family M23/M37"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L387 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Shewana3_4303 peptidase M23B (RefSeq) (Shewanella sp. ANA-3)
MYSTDVVKENAYLSATRSGLESNEIATLQRSLPSRFNLRHLKKNESLKLVLQKKAGKSHV
VAYKFTSGSFNYTAYRISDKKFYNLSDTSGKGSLDYPLPATARLSSPFNPARLNPVSGKV
SPHNGIDYSMPMNTKIVSVIDGKITRAEYNSTMGYFVEVTGKAGVKTRYLHLNKILVTKG
ARVTRGGAIALSGNSGRSSGPHLHYELVINNNPVNSLAFRAAAPADNKLEQHAFAHARDY
ERYLD