Protein Info for Shewana3_4290 in Shewanella sp. ANA-3

Annotation: copper resistance D domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 150 to 174 (25 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details PF05425: CopD" amino acids 188 to 288 (101 residues), 75.3 bits, see alignment E=2.3e-25

Best Hits

KEGG orthology group: K07245, putative copper resistance protein D (inferred from 100% identity to shn:Shewana3_4290)

Predicted SEED Role

"Copper resistance protein D" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L374 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Shewana3_4290 copper resistance D domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MILTVFEISVLISKWVIYLSVAAVIGGTLMQYLIKGQLNLSISVAKYTGLGAVLGLIAVS
INYFAQVGAFAENGLMGIFDAQMHAFLWPTQVGQTVLWRLIGFGLMLVASGLLLHKNRYI
KTFSAVLAILSCLLIAVTFTFIGHSTELGLLAQGLILIHVLIIGSWIGAFYPLWKLCCTD
DHIVIKNVMDTFGRLGIVIVILVLLSGMGMVWMLFDSPTELISSDYGIAVTIKLCLVAII
LLIAAWHKLVLVPKLTIANTLLAKQKLQKSIGLEALIAVLILATTAVLSSVLGPMSLG