Protein Info for Shewana3_4287 in Shewanella sp. ANA-3

Annotation: CopA family copper resistance protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 642 signal peptide" amino acids 1 to 47 (47 residues), see Phobius details TIGR01480: copper-resistance protein, CopA family" amino acids 19 to 642 (624 residues), 833.1 bits, see alignment E=6.1e-255 PF07732: Cu-oxidase_3" amino acids 65 to 176 (112 residues), 125.2 bits, see alignment E=2.2e-40 amino acids 532 to 636 (105 residues), 28.1 bits, see alignment E=2.7e-10 PF00394: Cu-oxidase" amino acids 186 to 348 (163 residues), 78.3 bits, see alignment E=1.1e-25 PF07731: Cu-oxidase_2" amino acids 525 to 641 (117 residues), 87.6 bits, see alignment E=1e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_4287)

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L371 at UniProt or InterPro

Protein Sequence (642 amino acids)

>Shewana3_4287 CopA family copper resistance protein (RefSeq) (Shewanella sp. ANA-3)
MKSQYMIKPMIQMTNSELNNSRRRFVFGASAMLALMSIPFPKNAVANALSQSLSQLSGKV
FDLTIDYKMVNFTGKSARATVVNQLLPAPLLRWKEGETVTLRVKNNLDHDSSIHWHGIIL
PTEMDGVPGFSFDGIKPGETFEYQFTVQQSGTYWYHSHSGYQEQTGLFGAIVIDPATPDP
VIYDRDYVIMLSDWSDEAPENIYAKLKKQADYYNYRERTVMDFFSDVNKNGLANTWNARS
MWNNARMSDRDISDVTGSTYTYLMNGNPPQQGWQGLFEQGEKVRLRFINSSAMTIFDVRI
PGLKMSVVASDGQNIQPVSVDEFRIGVAETYDVVIEPEVDNAYCIFAQSIDRTGFTVGNL
TSDASLHAPIPPMDPRPVLGHSDMGMDMSDMDMSGMDHSKMDMGAGDMSGMDHSKMAMGG
GDMSGMDHSKMAMGGGDMSGMDHSKMAMDAAKATVSGLGLAGFGSNNEIKHIDTEFGPQV
DMRADAPKSGLHDPGIGLRDHQQQFNRKVLTYGDIKGLHPTYDTRQPSREIQLHLTGNMN
RYMWSVNGVKFMDAAPLEFEYGERLRITLVNDTMMTHPMHLHGMWSELETGDPDFIPRKH
TVLVQPGSKISYLVTADAKGQWAYHCHLLFHMPGMFRKVVVK