Protein Info for Shewana3_4154 in Shewanella sp. ANA-3

Annotation: CzcA family heavy metal efflux protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1046 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 342 to 362 (21 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details amino acids 397 to 419 (23 residues), see Phobius details amino acids 448 to 469 (22 residues), see Phobius details amino acids 481 to 507 (27 residues), see Phobius details amino acids 529 to 555 (27 residues), see Phobius details amino acids 875 to 894 (20 residues), see Phobius details amino acids 901 to 920 (20 residues), see Phobius details amino acids 926 to 951 (26 residues), see Phobius details amino acids 972 to 992 (21 residues), see Phobius details amino acids 1004 to 1027 (24 residues), see Phobius details TIGR00914: heavy metal efflux pump, CzcA family" amino acids 1 to 1040 (1040 residues), 1526 bits, see alignment E=0 PF00873: ACR_tran" amino acids 6 to 1029 (1024 residues), 1022.4 bits, see alignment E=0 PF03176: MMPL" amino acids 864 to 1031 (168 residues), 26.4 bits, see alignment E=3.4e-10

Best Hits

Swiss-Prot: 59% identical to CZCA_ALCSC: Cation efflux system protein CzcA (czcA) from Alcaligenes sp. (strain CT14)

KEGG orthology group: K07239, heavy-metal exporter, HME family (inferred from 62% identity to ajs:Ajs_1849)

MetaCyc: 60% identical to cation efflux system protein (Pseudomonas putida KT2440)
RXN1G01-61; TRANS-RXN0-200; TRANS-RXN0-244

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcA; Cation efflux system protein CusA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2X7 at UniProt or InterPro

Protein Sequence (1046 amino acids)

>Shewana3_4154 CzcA family heavy metal efflux protein (RefSeq) (Shewanella sp. ANA-3)
MIDKLIQFSIARRWLVMFLVLVTGALGVWNYQQLPIDAVPDITNVQVQINTEAPGYSPLE
VEQRITYLVELAITGLPYVESTRSISRYALSQVTVVFEKGTDIYFARNLINERLQQAKSE
MPSGIDPAMGPVATGLGEIFHYAVHAKPGALMENGEPYDATALRTLQDWVIRPQLRLVPG
VTEVNTIGGFEKQFHVTPEPSKLLAYQLSFDDLVAALEKNNANIGAGYIEKNGEQYLIRA
PGQVADIPAIEKIIVARRAGLPITVADVAEVGFGKELRTGAATRDGEETVLGTAVMLLGG
NSRTVSQDVSAKLLEINKTLPEGVIAEPVYNRTVLVDKTIATVQANLAEGAVLVVVVLLI
MLGNVRAALLTAMVIPLSMLMLMTGMVQTKVSANLMSLGALDFGLIVDGAVIIVENCIMR
LAGRQHHLGRTLKLDERFQTVFAATREVFAPSLISVLVVILVNLPILALTGVEGKMFTPM
AMAVIMALLSALVLSLTFVPAAVALFMTGHIEEKDNFIVRHSKRFYAPVLAWALKFRVLV
LSAALIFVVLVGALATRMGTEFIPNLDEGDIAVQALRIPGTSLTQSLDMQFQLEKAVLEI
PEVKTYFARVGTAEVASDPMGPNISDGYVMLRDRSEWPDPDKTKAQLLEEIGEKLTLLPG
NAYEISQPIQLRFNELISGVRSDLGIKVFGDDLDQLLKSGSEIAAVLTGIEGAEGVKVEQ
VSGLPILSINADRSAMYRYGLNVADVQDVVAAATGGEEAGLIFEGDQRFSIVVRVAEGIR
GDLRALERLPIPLPEGGYVPLREVASLTLAPGPNQISRENGKRRLVVSANVRGRDLGGFV
AEVQGKVAQQVKLPPGYWLEYGGTFEQLQSASQRLSLLVPVTLVMIFALLMMTFGSAKDA
ALVFSGVPLALTGGVIALWLRDIPLSITAGVGFITLCGVSVLTGVMMVSAFRDELNRGES
VEQAIQGGAMLRLRPILMVALVAALGFLPMALNTSTGAEVQRPLATVVIGGIISSTLLTL
LVLPGLYRLAWRKPKEIDDNGVPIAQ