Protein Info for Sama_3654 in Shewanella amazonensis SB2B

Name: gidB
Annotation: 16S rRNA methyltransferase GidB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 PF02527: GidB" amino acids 21 to 200 (180 residues), 192.2 bits, see alignment E=5.5e-61 TIGR00138: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG" amino acids 26 to 202 (177 residues), 170 bits, see alignment E=2.1e-54 PF13847: Methyltransf_31" amino acids 67 to 143 (77 residues), 27.5 bits, see alignment E=2.4e-10

Best Hits

Swiss-Prot: 100% identical to RSMG_SHEAM: Ribosomal RNA small subunit methyltransferase G (rsmG) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K03501, ribosomal RNA small subunit methyltransferase G [EC: 2.1.1.170] (inferred from 100% identity to saz:Sama_3654)

MetaCyc: 60% identical to 16S rRNA m7G527 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11578 [EC: 2.1.1.170]

Predicted SEED Role

"rRNA small subunit 7-methylguanosine (m7G) methyltransferase GidB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SBV0 at UniProt or InterPro

Protein Sequence (206 amino acids)

>Sama_3654 16S rRNA methyltransferase GidB (RefSeq) (Shewanella amazonensis SB2B)
MLAEKLSQDLAKAGLQVDAQQQQQLLAFVALLDKWNKAYNLTSVREPAQMLTRHILDSLV
VSPHLVGSRFIDVGTGPGLPGIPLAIINPDKEFVLLDSLGKRIRFQKQVAVELGLKNISS
VESRVELYQPEQGFDGVLSRAFASVGDMLSWCHHLPAENGSFYALKGQLGDEEMAGIPEG
FKLIETIRLTVPGLDEQRHLLKLVKA