Protein Info for Sama_3652 in Shewanella amazonensis SB2B

Annotation: ParB family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 40 to 211 (172 residues), 202.9 bits, see alignment E=1.9e-64 PF02195: ParBc" amino acids 42 to 130 (89 residues), 110.6 bits, see alignment E=4.9e-36 PF17762: HTH_ParB" amino acids 180 to 229 (50 residues), 59.3 bits, see alignment 3.9e-20 PF23552: ParB_dimer" amino acids 243 to 292 (50 residues), 79.9 bits, see alignment 1.1e-26

Best Hits

Swiss-Prot: 58% identical to PARB_PSEPK: Probable chromosome-partitioning protein ParB (parB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 100% identity to saz:Sama_3652)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SBU8 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Sama_3652 ParB family protein (RefSeq) (Shewanella amazonensis SB2B)
MTLKKRGLGKGLDALLSTSHAASRKLEQEAARADKQDDLVHLDVDLLQPGKYQPRKDMSP
EALEELAESIRAQGIIQPIVVRKVAEQKYEIIAGERRWRASQLAKLEKVPCIIKQVPDES
AVAIALIENIQREDLNAMEEAIALHRLLEEFELTHQQVADAVGKSRTTVTNLLRLNSLNE
PVKRLLEYGDIDMGHARALLAVEGEEQTNLARLVAAKELTVRETERLINRTLNPAKEAEK
PVKDHDVSRLEQQLIEKLGAKVSIAHGSKGKGKIVINYQNLAELDGILSKIR