Protein Info for Sama_3616 in Shewanella amazonensis SB2B

Annotation: iron-sulfur cluster-binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 580 PF13237: Fer4_10" amino acids 220 to 259 (40 residues), 29.2 bits, see alignment 3.6e-10 PF12838: Fer4_7" amino acids 221 to 262 (42 residues), 31.1 bits, see alignment 1.4e-10 PF12800: Fer4_4" amino acids 245 to 261 (17 residues), 11.1 bits, see alignment (E = 0.00024) amino acids 448 to 462 (15 residues), 15.5 bits, see alignment (E = 9.5e-06) amino acids 480 to 493 (14 residues), 14.3 bits, see alignment (E = 2.2e-05) PF00037: Fer4" amino acids 444 to 466 (23 residues), 21.9 bits, see alignment (E = 5.8e-08) amino acids 478 to 496 (19 residues), 21.4 bits, see alignment (E = 8.4e-08) PF13187: Fer4_9" amino acids 449 to 496 (48 residues), 30 bits, see alignment 2.2e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_3616)

Predicted SEED Role

"Iron-sulfur cluster-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SBR2 at UniProt or InterPro

Protein Sequence (580 amino acids)

>Sama_3616 iron-sulfur cluster-binding protein (RefSeq) (Shewanella amazonensis SB2B)
MRKINRKTPTLTYRNSQRTVQERNVSMIETTRRARHADIRSQVLAQTRILGNLIPPTVSY
STEGHVLILGAEDLARLAAGKLSAMASLVILATDDISSQDEAHLERVMNAAPDVESYYNK
LVSIKGFLGQFQATVEQNGTQAQLSTVAIRRPHFDIVLDLSIEPAIQLELLPPGYFHVGQ
DEAKLADAVAQIPDLVGQFDKPRYVKVNADLCAHNRNGLNGCNRCLNFCPADAIQSVEKK
IEIDPYLCHGAGSCTNACPTGAISYDLPNPQALHSFLNKLVSRFRDEALEAPVILFHDQN
QGAALINDTLPGEVLPVALEEITVASMDHWLAALAWGAREVLVLNTQATAPTLTTMLKGE
IALACRILAEMGQPERVRLIDEAELAALTPALDISLDWPVTVPAAFGGGSKRDTLYAAID
HLNSQAADINSILPMGNIPFGKVTVATDNCTLCMSCVAICPTAALKDGGDEPKLLFTEQN
CVQCGLCEAACPEKVISLVPQVNFDAPSRQAARVLKEEKPFECVRCGAPFATQSMVHRML
DMVGMHSAFSANIERLKMCGDCRVKDMFEDILQDPEKQLR