Protein Info for Sama_3589 in Shewanella amazonensis SB2B

Annotation: HlyD family secretion protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 45 to 83 (39 residues), 33.1 bits, see alignment 5.8e-12 PF13437: HlyD_3" amino acids 198 to 275 (78 residues), 25.6 bits, see alignment E=2.6e-09

Best Hits

KEGG orthology group: K01993, HlyD family secretion protein (inferred from 100% identity to saz:Sama_3589)

Predicted SEED Role

"Predicted membrane fusion protein (MFP) component of efflux pump, membrane anchor protein YbhG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SBN5 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Sama_3589 HlyD family secretion protein (RefSeq) (Shewanella amazonensis SB2B)
MKLIKSPHWVALFALCLTACGESSSAVYGTVERDRLTLTAPTTELIAEIKVREGDRVSAG
TVLLQLDSRAADARLAQAVANLAQAEARLAELTKGARDEELARAEARLAGARATLSEARA
QYERTVRLVAEKVLTAADLDRAVAGKDRAQADVDSASQALKELIAGTRSEQLSQAAAAVE
AAQAQVTLEQKFKSDLTLMAARDAVVDLLPWRVGDRVNQGSQLVGLLVQNAPYVRVYLPA
SALDKLLPGAEVGVRVDGRPEPVMGKVRNIRSEPAFTPFYALNERDRARLMYLTDIDLPV
DAGLATGLAVEVLLPEANHE