Protein Info for Sama_3565 in Shewanella amazonensis SB2B

Annotation: DMT family permease (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 138 to 155 (18 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 211 to 230 (20 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details PF00892: EamA" amino acids 3 to 129 (127 residues), 52.1 bits, see alignment E=4e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_3565)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SBL1 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Sama_3565 DMT family permease (RefSeq) (Shewanella amazonensis SB2B)
MNIILAMLTAALWGTTYGVTQYTLPDWPPLLLGAIRALPAGIILWCFRPRFPVREHGLAL
LKLGAVNIALFFSLIFVMAHTLPSAISGVGMVSVPLFAMIFQFVVLKHKPSGAQILAGVL
LLVLGLMLFNPASLSLNPVGLVAMFAAISCIILGSRMTQTLSGRMHWWDVLVWQLILGGA
LLALIGSGQWLIAPGGFAAVADGISGREFAGIAWIVLFNTVLAYGLYVFLMQRMSIVDFT
FGGIANPITGIALGVLLMGEQYSHTQYMLMAGMIVSSLLPSLWQRFKRPAN