Protein Info for Sama_3541 in Shewanella amazonensis SB2B

Annotation: pirin-like protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 PF02678: Pirin" amino acids 25 to 122 (98 residues), 92.4 bits, see alignment E=1.8e-30 PF05726: Pirin_C" amino acids 186 to 273 (88 residues), 69.7 bits, see alignment E=2.6e-23

Best Hits

Swiss-Prot: 53% identical to Y1205_PSEAE: Putative quercetin 2,3-dioxygenase PA1205 (PA1205) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06911, (no description) (inferred from 100% identity to saz:Sama_3541)

Predicted SEED Role

"Pirin-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SBI7 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Sama_3541 pirin-like protein (RefSeq) (Shewanella amazonensis SB2B)
METEATQPVTERLLPRTSDVGGIPVARAIPQKARRLIGPWCFLDHLGPISGPATVNVGEH
PHTALQTFTWMMAGEILHRDSLGSAQVIRPGQVNLMTAGHGIAHTEESLPNQTHLHAAQF
WIALPAAHKDTAPRFDHYPTLPRWQDAGANFTLLVGDWGNHRSPVLHFSPILGLEIFHSA
DTGAPVTLTLPLEPTFEYGLMPLEGSFQLAGESFSDNQLAFVNRGETSVTIRLQAGCRLL
LIGGEPLTDDITIWWNFVGHSKADIAEAQAQWLAQDPRFGPVTGYQGQRLEPPPIPW