Protein Info for Sama_3538 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 55 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 30 to 52 (23 residues), see Phobius details PF01679: Pmp3" amino acids 6 to 52 (47 residues), 74.2 bits, see alignment E=3.4e-25

Best Hits

Swiss-Prot: 59% identical to PMP3_CANAX: Plasma membrane proteolipid 3 homolog (PMP3) from Candida albicans

KEGG orthology group: None (inferred from 100% identity to saz:Sama_3538)

Predicted SEED Role

"Plasma membrane protein involved in salt tolerance"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SBI4 at UniProt or InterPro

Protein Sequence (55 amino acids)

>Sama_3538 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MDTNKLLLVIIAILLPPVAVFLKEGAGKHLLINIILCLFFWVPGLLHALWVVTKS