Protein Info for Sama_3528 in Shewanella amazonensis SB2B

Annotation: molybdenum cofactor biosynthesis protein E (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02391: MoaE
  • amino acids 8 to 121 (114 residues), 142 bits, E=4.5e-46

Best Hits

Swiss-Prot: 60% identical to MOAE_VIBCH: Molybdopterin synthase catalytic subunit (moaE) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03635, molybdopterin synthase catalytic subunit [EC: 2.-.-.-] (inferred from 100% identity to saz:Sama_3528)

MetaCyc: 57% identical to molybdopterin synthase catalytic subunit (Escherichia coli K-12 substr. MG1655)
RXN-8342 [EC: 2.8.1.12]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaE" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (5/6 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• Puromycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.8.1.12

Sequence Analysis Tools

See A1SBH4 at UniProt or InterPro

Protein Sequence (152 amino acids)

>Sama_3528 molybdenum cofactor biosynthesis protein E (RefSeq) (Shewanella amazonensis SB2B)
MSQNRILVQTADFSVPEEYQRIAADNQDGAVVTFVGKVRDFNEGNQVSDLTLEHYPGMTE
KVLDQIADQARERWPLNHLTIIHRVGTMHLGEQIVFIGVSSAHRKAAFAACEFLIDFLKT
KAPFWKLETSDKGQGWVEARDADDQAAKAWEQ