Protein Info for Sama_3508 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 778 PF09371: Tex_N" amino acids 9 to 193 (185 residues), 234.9 bits, see alignment E=2e-73 PF16921: Tex_YqgF" amino acids 325 to 453 (129 residues), 177.7 bits, see alignment E=4.3e-56 PF14639: YqgF" amino acids 338 to 460 (123 residues), 42.4 bits, see alignment E=2.3e-14 PF14635: HHH_7" amino acids 467 to 558 (92 residues), 33.7 bits, see alignment E=1.4e-11 PF12836: HHH_3" amino acids 493 to 557 (65 residues), 101.6 bits, see alignment E=7.4e-33 PF17674: HHH_9" amino acids 563 to 632 (70 residues), 81.4 bits, see alignment E=2.4e-26 PF00575: S1" amino acids 651 to 722 (72 residues), 81.4 bits, see alignment E=1.8e-26

Best Hits

KEGG orthology group: K06959, uncharacterized protein (inferred from 100% identity to saz:Sama_3508)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SBF4 at UniProt or InterPro

Protein Sequence (778 amino acids)

>Sama_3508 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MTSNIARIIADELNVREAQVTATIALLDDGATVPFVARYRKEVTGGLDDTQLRTLHSRLG
YLRELNDRRDVILSSIDAQGKLTPELKAAILGADSKTRLEDLYLPYKPKRRTKGQIAIEA
GIEPLANLLLQQRPANPEAEAAAFINTEAGFADTRAVLDGARYILMERFAEDAELIRKVR
EHLSGVAVLQSKVIEGKEKEGAKFRDYFEHSELLAKVPSHRALAMLRGRNEGILSLSMVA
DPDSEPGSGSYCEVIIANHLGLTLGDSEADKWLKTVVTGTWRIKVALQMETEFISRLREQ
AEDDAIKVFARNLHDLLMAAPAGSKATMGLDPGLRTGVKVAVVNDTGKLVAHSTIFPHEP
QNQWDKSLRTLANLVSMHKVELIAVGNGTASRETDKLAAELIAAVKEHHPTLTKVMVSEA
GASVYSASELAANEFPDLDVSIRGAVSIARRLQDPLAELVKIEPKSIGVGQYQHDVSQSQ
LSQSLEAVVEDCVNSVGVDVNMASVPLLSQVSGLNKTLAKNLVDYRDEHGQFKSRKELLK
VPRLGPKAFEQAAGFLRIREGDNPLDASAVHPEAYSLVETIAQTREVPLANLIGNTELIR
TLKAGDFVTDAFGLPTVTDILKELDKPGRDPRGEFKTAHFKEGVTEVRDLKPEMILEGVV
TNVTNFGAFVDVGVHQDGLVHISSLSDKFVSDPHTVVKAGDVVKVKVMEVDVERKRIGLS
MRLDEKPQPAQAAKGKGAPAARTAQAKGGKPQSKPQKPQAINAAMGNAFADAFAKMKK