Protein Info for Sama_3474 in Shewanella amazonensis SB2B

Annotation: heavy metal efflux system protein, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF19335: HMBD" amino acids 45 to 71 (27 residues), 44.8 bits, see alignment (E = 1.9e-15) amino acids 90 to 116 (27 residues), 52.1 bits, see alignment (E = 1e-17) amino acids 159 to 186 (28 residues), 54.3 bits, see alignment (E = 2e-18) TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 210 to 510 (301 residues), 127 bits, see alignment E=3.8e-41 PF16576: HlyD_D23" amino acids 218 to 434 (217 residues), 265.7 bits, see alignment E=4.9e-83 PF13437: HlyD_3" amino acids 332 to 430 (99 residues), 54.4 bits, see alignment E=4e-18

Best Hits

KEGG orthology group: K07798, Cu(I)/Ag(I) efflux system membrane protein CusB (inferred from 100% identity to saz:Sama_3474)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SBC0 at UniProt or InterPro

Protein Sequence (526 amino acids)

>Sama_3474 heavy metal efflux system protein, putative (RefSeq) (Shewanella amazonensis SB2B)
MNTKKQKSALLLMGASLAFGPGMPAMVLAESPQQSPASEAAAAAVYHCPMHPEVESHEPG
RCPKCKMFLVPGAGISGQSSEPLAEAHKTYICPMHPEVESHEPGRCPKCNMFLVEKEEEE
EADPQPEHKSTEDHSAHLAAQNDIFATPAASPIDGGKVKYVCPMHAHIISDEPGTCPICG
MDLEKVELGGGQEVLVDVSGGMQQALALRVAKAERQTLWKFVDTVGQIEYDERQIHHVHA
RLNGWIETLKVNAVGDKVSKGQLLYEIYSPDLVNAQDDYLLALDTVKKSGDSGRYKELLR
KASLRLELLGMNEAQIKELAKTQTTQYRVPFYARQDGVITTLNTREGMYIQPMSEVLALT
DISKVWVIADVFENEQSWLKVGQPAEVAVPAMGLSGIKGTIDYIYPELDPVTRSLRVRVV
LDNPNQQLRPNTLAKVKLYGGPERDVLTIPQEALIQTGKENRVIVRTADNSFAARQVTVG
MYSQGKVEVLSGLSDGEEVVTSGQFLLDSEASLKGSLMRLGSGHQH