Protein Info for Sama_3468 in Shewanella amazonensis SB2B

Annotation: cell division protein FtsY (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 563 PF02881: SRP54_N" amino acids 270 to 336 (67 residues), 58.7 bits, see alignment E=1.1e-19 TIGR00064: signal recognition particle-docking protein FtsY" amino acids 283 to 555 (273 residues), 377.1 bits, see alignment E=2.5e-117 PF06414: Zeta_toxin" amino acids 351 to 461 (111 residues), 29.1 bits, see alignment E=1.2e-10 PF00448: SRP54" amino acids 355 to 555 (201 residues), 258.8 bits, see alignment E=6.1e-81

Best Hits

Swiss-Prot: 63% identical to FTSY_ECOLI: Signal recognition particle receptor FtsY (ftsY) from Escherichia coli (strain K12)

KEGG orthology group: K03110, fused signal recognition particle receptor (inferred from 100% identity to saz:Sama_3468)

Predicted SEED Role

"Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division or Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SBB4 at UniProt or InterPro

Protein Sequence (563 amino acids)

>Sama_3468 cell division protein FtsY (RefSeq) (Shewanella amazonensis SB2B)
MTDEALASKTAQCQHRPVPQMSKKGFFSWFRRDKDDAAAKQAEAEHAIVEQVQAESAAAE
QAEREAAEQAAAEVTRLEAEQLEAERIAAEQAEQERIAAEQAAAEAARLEAERQEEARLA
AEQLEAERIAAEQAEQERIAAEQAAAEAARLEAERQKEARLAAEQLEAERIAAEQAEQER
IAAEQAAAEAARLEAERQEEARLAAEQLEAERIAAEQAEQERIAAEQSAAEAASVQTEQA
EEVQPEPQAKPVKEGFFARLKRGLMRTSENIGSGFIGLFRGKKIDDELFEELEEQLLIAD
VGVETTSKLIKSLTEHASRRQLKDAEALYELLREEMQRTLEPVSVPLVPENAQGPYVILM
VGVNGVGKTTTIGKLAKQYQSQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVVAQHTGA
DSASVLFDALQSAKAKGVDVLICDTAGRLQNKNHLMEELKKVVRVMKKLDESAPHEVMLT
LDASTGQNAISQAKLFQEAVGVTGISITKLDGTAKGGVIFAIADKFGIPIRYIGVGEQID
DLRVFNARDFIDALFSQEKTDNT