Protein Info for Sama_3460 in Shewanella amazonensis SB2B

Annotation: 2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylate synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 572 TIGR00173: 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase" amino acids 15 to 445 (431 residues), 425.9 bits, see alignment E=1.1e-131 PF02776: TPP_enzyme_N" amino acids 17 to 127 (111 residues), 70.4 bits, see alignment E=1.7e-23 PF16582: TPP_enzyme_M_2" amino acids 189 to 402 (214 residues), 241.1 bits, see alignment E=1.6e-75 PF02775: TPP_enzyme_C" amino acids 429 to 551 (123 residues), 33.2 bits, see alignment E=6.5e-12

Best Hits

Swiss-Prot: 100% identical to MEND_SHEAM: 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase (menD) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K02551, 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [EC: 2.2.1.9] (inferred from 100% identity to saz:Sama_3460)

Predicted SEED Role

"2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 2.2.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SBA6 at UniProt or InterPro

Protein Sequence (572 amino acids)

>Sama_3460 2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylate synthase (RefSeq) (Shewanella amazonensis SB2B)
MDHLHSSTAELNLLWGSLILEELTRHGVMHLCMAPGSRSTPLTLAAAAQDKLTRHLHFDE
RGLGFLALGLAKASQAPVAIITTSGTAVANLYPAIVEASLTHVPLIILSGDRPWELIGCG
ANQAIEQLGIFGGYARQLNLPTPDLRIGPEVLLSALDEQLANLDRPLHINCMYPEPLYPS
EHRFDQFDSYLSRLGQWQDTQVPYLSVANASLSAFPPRDAMMRFVHGKGVIVAGTLTEAE
TPTELITLSQKLGWPLLTDAQSQLRQHPGAIGHIDQLLLNPRARALLDQAERVLVFGGRL
LSKRLISYLAEKDWHSYWQVLPHQERLDPSHSNKQLWLGRAGDVCALEWPRSSEANWAAS
LISLNQSVEQDFIHHIDGGEFGEAQVIRAIAASHTAEQQLFIGNSLPVRLYDMFAPIGCC
AASTYTNRGASGIDGLIATACGVARHSGRPTTLILGDLSALHDLNSLALARDCQSPLVIV
VLNNDGGNIFNLLPVPTEELRSDFYRLSHGLEFGYGAAMFGLPYDRAEDMEAFIDAYQAA
LEHPGASVIEVTVAQDQASNQIRRMAEWIRSR