Protein Info for Sama_3443 in Shewanella amazonensis SB2B

Annotation: peptidase M16-like protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00675: Peptidase_M16" amino acids 55 to 157 (103 residues), 36 bits, see alignment E=6.7e-13 PF05193: Peptidase_M16_C" amino acids 202 to 379 (178 residues), 117.6 bits, see alignment E=6.2e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_3443)

Predicted SEED Role

"Insulinase-like:Peptidase M16, C-terminal"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SB89 at UniProt or InterPro

Protein Sequence (473 amino acids)

>Sama_3443 peptidase M16-like protein (RefSeq) (Shewanella amazonensis SB2B)
MMQYKPLLIVAALALAGCAATQDVKHTQEPAAAAFQLPAYEKVTLDNGLTVFLMQQKEVP
LITVNAVVRAGAVNDTSAGISALTAEGLMLGSAGKSKRDIENQVDFLGASLSAEAGKEGS
YISAKFMAKDLDTMLPLFADVLLRPDFDATEFDKLKQREVGGLIQAKESPRAVVGNYFGK
LVYGQHPYGNASGGNSESVAAITLPQVRAFYTGFYQPGNTSISVVGDFDVADMKAQLKRT
FGDWRSDAAPQQQSLKQGLPVLAKSRVLLVDKPDAMETTFLIGGMGISEDNPDAVGLTVV
NTILGGRFTSWLNDELRVNAGLTYGARSGFASYRDSGLFQISTFTKTDTTEAAIDLALKT
YARLWEQGIDQATLDSAKAYVKGQFPPRFETSGQLAGLLSDMYLYGFDNSYINDFERKVD
SLTLEETQRLIDTYFPKDKLQFVLIGNAAKVAPIAAKYGEVNQVNIKDVGFGG