Protein Info for Sama_3432 in Shewanella amazonensis SB2B

Annotation: response regulator receiver protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF00072: Response_reg" amino acids 5 to 113 (109 residues), 106 bits, see alignment E=1.2e-34 PF00486: Trans_reg_C" amino acids 153 to 225 (73 residues), 66.3 bits, see alignment E=2.2e-22

Best Hits

Swiss-Prot: 40% identical to YCF27_CYACA: Probable transcriptional regulator ycf27 (ycf27) from Cyanidium caldarium

KEGG orthology group: K07662, two-component system, OmpR family, response regulator CpxR (inferred from 100% identity to saz:Sama_3432)

Predicted SEED Role

"Copper-sensing two-component system response regulator CpxR" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SB78 at UniProt or InterPro

Protein Sequence (228 amino acids)

>Sama_3432 response regulator receiver protein (RefSeq) (Shewanella amazonensis SB2B)
MNHLLLVDDDPGLSELLKELLELEGFVLTLAHDGAEGLSKAVSSHFDLILLDVMLPKLNG
FEVLKQLRNHKQTPVLMLTARGDDIDRVVGLEIGADDYLPKPFNDRELVARIRAILRRAQ
PGTPQSQPPEEIQLGDLKLDPSRQEAWCAQSLINLTGTEFALLLQLASQAGELVSKETLS
ETVLGKRLMPFDRSLDMHLSNLRKKLPERSDGRPRVKTIRGKGYIWLK