Protein Info for Sama_3385 in Shewanella amazonensis SB2B

Annotation: histidine ammonia-lyase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 34% identical to HUTH_DEIRA: Histidine ammonia-lyase (hutH) from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

KEGG orthology group: K01745, histidine ammonia-lyase [EC: 4.3.1.3] (inferred from 100% identity to saz:Sama_3385)

Predicted SEED Role

"Putative histidine ammonia-lyase protein"

MetaCyc Pathways

L-histidine degradation VI (7/8 steps found)
L-histidine degradation I (4/4 steps found)
L-histidine degradation III (4/6 steps found)
L-histidine degradation II (3/5 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.3

Use Curated BLAST to search for 4.3.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SB31 at UniProt or InterPro

Protein Sequence (518 amino acids)

>Sama_3385 histidine ammonia-lyase (RefSeq) (Shewanella amazonensis SB2B)
MTNQSTEMKETVKFGYGALTIEQVVAIAKGARVELRRDQEYVEYIQRGARFIDSLLAEEG
VVYGVTTGYGDSCTVTVGLDLVHELPLHLSRFHGCGMGRELTPMQSRAVMACRLNSLAIG
KSGVSFELLERIETLINEDICPVIPEEGSVGASGDLTPLSYLAGVLIGERDVFYRGGRLP
SSEVFQKLNITPLKLRPKEGLALMNGTAVMTALACLAYDRADYLTRLSSRITAMASLTLK
GNSNHFDDILFAAKPHPGQSRVASWIRDDLNHHEHPRNSDRLQDRYSIRCAPHIIGVLAD
AQPMLRQFIENELNSANDNPIVDGEGEHILHGGHFYGGHIAFAMDSLKNLVANISDLIDR
QMALVMDPKFNNGLPANLSGAEGARRPINHGFKAVQIGVSAWTAEALKLTMPASVFSRST
ECHNQDKVSMGTIAARDCLRVLELTEQVAAAALLAMTQGMRLRIRQGELCESSLTASVAK
TLAQVSEACPLVTEDRPLEATLRQTLARIQAGEWEVCR