Protein Info for Sama_3358 in Shewanella amazonensis SB2B

Annotation: integral membrane domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 96 to 113 (18 residues), see Phobius details amino acids 120 to 137 (18 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 198 to 221 (24 residues), see Phobius details amino acids 232 to 251 (20 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details PF00892: EamA" amino acids 7 to 136 (130 residues), 66.2 bits, see alignment E=2e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_3358)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SB04 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Sama_3358 integral membrane domain-containing protein (RefSeq) (Shewanella amazonensis SB2B)
MQRAVLAGLLLLLVGNVFSALYDVSVKWLPEDANAGSFLLLRQLTSGLMLLPLWWLAGRP
QTQHLPIHLWRASVGVVGALFLILGLMALPLATVSSLFYSAPLIIMLLGWWLLGERVSAG
QWLCAILGFGGILLILAPTQIGWSGLMVLGAAVTFSVCQLLLRKLPATESPVVTILLYNL
LGLPIALIFAAFNNFAGFSWALLGVALASNLFLMAYHWFCVLAYRRARAADIAIGEYSGL
LFIVALGWWWFDEWPGEHVWWGAALVVLPSLISPLIAHLWQAISDVEVIR