Protein Info for Sama_3351 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 122 to 142 (21 residues), see Phobius details amino acids 148 to 165 (18 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details amino acids 274 to 291 (18 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details PF06738: ThrE" amino acids 16 to 254 (239 residues), 210.9 bits, see alignment E=2.1e-66 PF12821: ThrE_2" amino acids 281 to 402 (122 residues), 52.6 bits, see alignment E=5.6e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_3351)

Predicted SEED Role

"Protein of unknown function DUF1212"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SAZ7 at UniProt or InterPro

Protein Sequence (411 amino acids)

>Sama_3351 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MDTQGVDNAEFIEKRRFIIKLGKALHKFGTPAYRLETHLQNVSRMLGIEGYFLISPTSMT
FVLQHDADQEYNHVARVKPGELDLGSLARTDELVDELISGKRTLQDAMDRLEEIINKPNP
YGPLLTLLAFGSSAAAFAMLMGSGWNDVLWSGLLGLIVYALVYRAERSKRMAEMLEPLAA
IVCALGATFISQYDPGINIPVVILSGIIIFIPGLALTLGLAELAARDLMSGTMRIMDAVM
LLFKLYFGAILGLVVGKALFGEAIYMESQPVPRLAIWSAVPILSMALVIIFKARMKDAPW
GVLAGIVAFFSAMAGGIYLGDSIGIFIGAFAVGIYSNLFARWMKAPASIALLQGIVILVP
GSKTYIGLNVLISGETMLNQAHLGSQIFLIFMSLIAGLIFANVAVPPRRTL