Protein Info for Sama_3346 in Shewanella amazonensis SB2B

Annotation: CBS domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 102 to 119 (18 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details PF04982: HPP" amino acids 54 to 178 (125 residues), 145.7 bits, see alignment E=3.6e-47

Best Hits

KEGG orthology group: K07168, CBS domain-containing membrane protein (inferred from 100% identity to saz:Sama_3346)

Predicted SEED Role

"Membrane protein, HPP family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SAZ2 at UniProt or InterPro

Protein Sequence (182 amino acids)

>Sama_3346 CBS domain-containing protein (RefSeq) (Shewanella amazonensis SB2B)
MKFYLRRMKPKAACPPRPPMKKILWSWLGAFVGIYLVANLGQWMGPVEPGHMFVIGSFGA
SAVLVYGAPMADFSQPRNLILGNLFSALIGVTVWQLAGDNPVLASALAVSLAIAVMHLTR
TMHPPAGAAALIAVIGGDSVQRLGYLYAITPVLLGSLALLLVALVINNLSSNPKRHYPRY
WL