Protein Info for Sama_3318 in Shewanella amazonensis SB2B

Annotation: Na+/H+ antiporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 27 to 47 (21 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 251 to 274 (24 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details amino acids 366 to 393 (28 residues), see Phobius details amino acids 407 to 424 (18 residues), see Phobius details amino acids 450 to 468 (19 residues), see Phobius details amino acids 474 to 494 (21 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 162 to 465 (304 residues), 123.6 bits, see alignment E=5.3e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_3318)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SAW4 at UniProt or InterPro

Protein Sequence (508 amino acids)

>Sama_3318 Na+/H+ antiporter (RefSeq) (Shewanella amazonensis SB2B)
MDVTDLLELIPLILTLVLALLLRRTLIALGAGVVLGALILNDFSPVTSLKYLLNTLTSQF
YQQSQWQWWHLNVLFAMLLLGIMTSLLGRSGAVDEFGHWLSARVHSRRQARMGIIGLGFL
VFIDGIFSCLAVGSVGRPIARQYGMSPAQLSYMVDTTASPLCSLVPVASWGPYVMALLAA
ISFLPVSALDAFIAIASVNFYAVSALVLVGLGSLFNWGWSEHAVDATEQAAGVDNAHQQA
QRPKTPSPWPLMLPLLGLLVGALAFTLASGVTLAKEPGMAAWLAAADVGAAMRNASLTAV
VLAALMALWCGRGLHPLMIDMLVGLRSMALAVGILLLTWMIGALIKDLGSAARISALAND
LLSPSLLLAGIFALCAIMAFATGTSWGTFAIMIPLCAQVAQGMAPELLLPALAAVMAGSV
FGDHCSPISDTSILSATASGAAVHEHVTTQLPFALIAAIAALCGFQLLNLGASWWLAWAM
TLMVGIGLLLLWQLKQSSGNLLKQDGQA