Protein Info for Sama_3307 in Shewanella amazonensis SB2B

Annotation: multidrug resistance protein D (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 46 to 64 (19 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 153 to 153 (1 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 361 to 378 (18 residues), see Phobius details PF07690: MFS_1" amino acids 13 to 351 (339 residues), 128.8 bits, see alignment E=1.2e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_3307)

Predicted SEED Role

"Multidrug resistance protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SAV3 at UniProt or InterPro

Protein Sequence (381 amino acids)

>Sama_3307 multidrug resistance protein D (RefSeq) (Shewanella amazonensis SB2B)
MKTKPSLWLMLLLLMFPQIVETLYSPALVSISQAFAVSDTEASQTLSIYFIAFALGVAVW
GIVADAWGRRPTMLLGLSVYGISALVALQTDSFAVLMLARACSAFGIAVGSIVTQTMLRD
SFDGDALGKVFSLMGLGIALSPVIGMFTGGQLVLLGGHGAVFTLLLFMALVLLGCCVRFL
PETFPETVTRTQGTNQSFPLSALAKRMLADWHIWRSALLVAIYNIGLFSYYQLGGFAFAR
LGLTPEVFGYSGLLLGLGSCVGSYLNSRLIANEVSLQRRLLGAATLLLLGAVSLCLLQGS
VWFVLPMCLVVMAFGVAIPNVLSMALSDYKMYAGSAGALLGLMYYLLIGAGLALAGLIEH
LGWVLLGCAVAAWAVTLIHRR