Protein Info for Sama_3249 in Shewanella amazonensis SB2B

Name: dapF
Annotation: diaminopimelate epimerase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 TIGR00652: diaminopimelate epimerase" amino acids 2 to 274 (273 residues), 325.8 bits, see alignment E=1.1e-101 PF01678: DAP_epimerase" amino acids 4 to 122 (119 residues), 115.9 bits, see alignment E=1.2e-37 amino acids 153 to 267 (115 residues), 110.9 bits, see alignment E=4.1e-36 PF02567: PhzC-PhzF" amino acids 48 to 237 (190 residues), 30.7 bits, see alignment E=2.3e-11

Best Hits

Swiss-Prot: 100% identical to DAPF_SHEAM: Diaminopimelate epimerase (dapF) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K01778, diaminopimelate epimerase [EC: 5.1.1.7] (inferred from 100% identity to saz:Sama_3249)

MetaCyc: 68% identical to diaminopimelate epimerase (Escherichia coli K-12 substr. MG1655)
Diaminopimelate epimerase. [EC: 5.1.1.7]

Predicted SEED Role

"Diaminopimelate epimerase (EC 5.1.1.7)" in subsystem Lysine Biosynthesis DAP Pathway (EC 5.1.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SAP5 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Sama_3249 diaminopimelate epimerase (RefSeq) (Shewanella amazonensis SB2B)
MIHFTKMHGLGNDFMVVDGVTQNVFFSPEQIRRLADRNFGIGFDQLLLVEPPYDPDLDFH
YRIFNADGSEVEQCGNGARCFARFVRNKGLTQKHKIKVSTSAGKMTLRLERDGGVTVNMG
VPILDPAQIPFKAKKFEKTYLLQSAQQTFLCGAVSMGNPHVVLEVDDITQAPVADVGAQL
TRHERFPKGVNVGFMQVVAPDHIKLRVYERGAAETLACGSGACAAAVVGQLQGKLGSRVR
VDLPGGSLTINWEGEGKPLWMTGPAQQVYDGQIQL