Protein Info for Sama_3246 in Shewanella amazonensis SB2B

Annotation: HAD-superfamily hydrolase, subfamily IA, variant 1 family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF00702: Hydrolase" amino acids 10 to 201 (192 residues), 45.1 bits, see alignment E=2.5e-15 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 117 to 201 (85 residues), 27.4 bits, see alignment E=2e-10 PF13242: Hydrolase_like" amino acids 162 to 207 (46 residues), 30.8 bits, see alignment 3.2e-11

Best Hits

Swiss-Prot: 38% identical to YIGB_SHIFL: Flavin mononucleotide phosphatase YigB (yigB) from Shigella flexneri

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to saz:Sama_3246)

MetaCyc: 38% identical to 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase (Escherichia coli K-12 substr. MG1655)
RIBOPHOSPHAT-RXN [EC: 3.1.3.104]; RXN0-5187 [EC: 3.1.3.104, 3.1.3.102]

Predicted SEED Role

"Putative FMN hydrolase (EC 3.1.3.-); 5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase" (EC 3.1.3.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.- or 3.1.3.102 or 3.1.3.104

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SAP2 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Sama_3246 HAD-superfamily hydrolase, subfamily IA, variant 1 family protein (RefSeq) (Shewanella amazonensis SB2B)
MQIFRRLKPIAAISFDLDDTLYDNRPVIMAAELAQLMYLARHYPVTKAWGRDEWRHHKLR
VLAHHPVLAHDPTALRLLTLHSGLLYFGLSEADATTAAGAVMDEFIRARSHFRVPESSLQ
LLAKLGQKYPLIGLTNGNVDPERIGLGDRLVFVLAAGSGVRMKPVDDLFRMGCNRLGIAS
EQLLHVGDSHSADVVGALKAGCQAVLLNPAHGGVEPGPLASPLPHLQIQRLDALLALL