Protein Info for Sama_3222 in Shewanella amazonensis SB2B

Annotation: fumarate reductase cytochrome b-556 subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01127: Sdh_cyt
  • amino acids 112 to 212 (101 residues), 41.8 bits, E=5.4e-15

Best Hits

Swiss-Prot: 42% identical to FRDC_HELPY: Fumarate reductase cytochrome b subunit (frdC) from Helicobacter pylori (strain ATCC 700392 / 26695)

KEGG orthology group: K00246, fumarate reductase subunit C (inferred from 100% identity to saz:Sama_3222)

MetaCyc: 42% identical to fumarate reductase cytochrome b subunit (Helicobacter pylori 26695)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Fumarate reductase cytochrome b subunit" in subsystem Succinate dehydrogenase

MetaCyc Pathways

• mixed acid fermentation (15/16 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• glycerol-3-phosphate to fumarate electron transfer (2/2 steps found)
• hydrogen to fumarate electron transfer (2/2 steps found)
• succinate to cytochrome bd oxidase electron transfer (2/2 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• TCA cycle VI (Helicobacter) (7/9 steps found)
• partial TCA cycle (obligate autotrophs) (6/8 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to fumarate electron transfer (1/2 steps found)
• succinate to cytochrome aa₃ oxidase electron transfer (1/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (1/2 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
• aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
• reductive TCA cycle I (7/11 steps found)
• incomplete reductive TCA cycle (4/7 steps found)
• TCA cycle VII (acetate-producers) (5/9 steps found)
• pyruvate fermentation to propanoate I (3/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• reductive TCA cycle II (6/12 steps found)
• methylaspartate cycle (9/19 steps found)
• L-glutamate degradation VIII (to propanoate) (3/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Oxidative phosphorylation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.5.1

Sequence Analysis Tools

See A1SAL8 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Sama_3222 fumarate reductase cytochrome b-556 subunit (RefSeq) (Shewanella amazonensis SB2B)
MNSARTLTEHTLNPRTAGHPWSARADRLQSLTGLMLGGFLLLHMHFESSILLGKEVFYQV
VQLLEGGMFSSTGHGFPWVTKAFSVLVLVVVCLHAALALRRFPTQLGQWRLLRSHLGSIA
HKDTHAWFWQLITGFVLFFLVPVHLFTMILNPEIGPHLSAERVFHNNAWVLYALLLPAVV
VHAMIGLYRVSVKWGWVVHRKPLRKVVKLLIVYLLCLGTSSLVAYMFIGSSLTLPVTPFS
PAG