Protein Info for Sama_3160 in Shewanella amazonensis SB2B

Annotation: ribosomal protein S6 modification protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF18030: Rimk_N" amino acids 1 to 94 (94 residues), 137.6 bits, see alignment E=2.9e-44 TIGR00768: alpha-L-glutamate ligase, RimK family" amino acids 2 to 286 (285 residues), 271.2 bits, see alignment E=4.9e-85 PF08443: RimK" amino acids 98 to 286 (189 residues), 231.5 bits, see alignment E=1.2e-72 PF02655: ATP-grasp_3" amino acids 99 to 263 (165 residues), 31.3 bits, see alignment E=4.3e-11 PF02955: GSH-S_ATP" amino acids 114 to 273 (160 residues), 66.5 bits, see alignment E=4.1e-22

Best Hits

Swiss-Prot: 100% identical to RIMK2_SHEAM: Probable alpha-L-glutamate ligase 2 (rimK2) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K05844, ribosomal protein S6 modification protein (inferred from 100% identity to saz:Sama_3160)

MetaCyc: 62% identical to ribosomal protein S6 modification protein (Escherichia coli K-12 substr. MG1655)
6.3.2.-

Predicted SEED Role

"Ribosomal protein S6 glutaminyl transferase" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SAF6 at UniProt or InterPro

Protein Sequence (301 amino acids)

>Sama_3160 ribosomal protein S6 modification protein (RefSeq) (Shewanella amazonensis SB2B)
MKIGVLSQFPELYSTRRLVEACESRGHEAWVINPINCYMNINSVKPSIHLEGEEVPMFDA
IIPRIHASVTFYGCAVVRQFEMMGVFAANDSISIARSRDKLRALQLLSRKGIGMPVTGFA
NKPNNIPDLINMVGGAPLVIKLLEGTQGIGVVLAETRKAAESVIEAFLGLKANIMVQEYI
KEANGSDIRCFVVGDKVVAAMRRQGPEGDFRSNLHLGGSAEPVKITPQERKSAVAAAKAM
GLVVAGVDILRSARGPLVLEVNSAPGIEGIEQATGIKVAEPIVEYIEKVVAARRANHQVI
A