Protein Info for Sama_3092 in Shewanella amazonensis SB2B

Annotation: phosphocarrier protein NPR (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 91 TIGR01003: phosphocarrier, HPr family" amino acids 4 to 84 (81 residues), 76.9 bits, see alignment E=4.7e-26 PF00381: PTS-HPr" amino acids 5 to 84 (80 residues), 92.1 bits, see alignment E=9.3e-31

Best Hits

Swiss-Prot: 72% identical to PTSO_SHEVD: Phosphocarrier protein NPr (ptsO) from Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)

KEGG orthology group: K08485, phosphocarrier protein NPr (inferred from 100% identity to saz:Sama_3092)

Predicted SEED Role

"Phosphocarrier protein, nitrogen regulation associated"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SA88 at UniProt or InterPro

Protein Sequence (91 amino acids)

>Sama_3092 phosphocarrier protein NPR (RefSeq) (Shewanella amazonensis SB2B)
MPKLERDVTIVNKLGLHARAATKLAVLASEFKASVTLVQGAKQASAASVLGLLMLESGMG
KTIHIIAEGEDAEQAMDAVCNLINARFDEDC