Protein Info for Sama_3090 in Shewanella amazonensis SB2B

Annotation: nitrogen regulatory IIA protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01419: PTS IIA-like nitrogen-regulatory protein PtsN
  • amino acids 3 to 145 (143 residues), 150 bits, E=2.1e-48
• PF00359: PTS_EIIA_2
  • amino acids 18 to 145 (128 residues), 115 bits, E=1.4e-37

Best Hits

Swiss-Prot: 54% identical to PTSN_KLEOX: Nitrogen regulatory protein (ptsN) from Klebsiella oxytoca

KEGG orthology group: K02806, PTS system, nitrogen regulatory IIA component [EC: 2.7.1.69] (inferred from 100% identity to saz:Sama_3090)

Predicted SEED Role

"PTS IIA-like nitrogen-regulatory protein PtsN"

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

See A1SA86 at UniProt or InterPro

Protein Sequence (147 amino acids)

>Sama_3090 nitrogen regulatory IIA protein (RefSeq) (Shewanella amazonensis SB2B)
MELSTILAPECTSCATPGSKKKVLELISDLAAAQNPSLSSQEIFESLLAREKMGSTGIGN
GIAIPHGRLGTIDKPLAVLIKCEEAIGYDAIDKQPVDILFALLVPSDQCQQHLSTLAAMA
EKLNDKQILKQLRKSHDEKELYQVIIG