Protein Info for Sama_3035 in Shewanella amazonensis SB2B

Annotation: membrane protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 178 to 195 (18 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details amino acids 262 to 280 (19 residues), see Phobius details PF00892: EamA" amino acids 7 to 136 (130 residues), 53 bits, see alignment E=2.2e-18 amino acids 148 to 274 (127 residues), 53 bits, see alignment E=2.4e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_3035)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SA31 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Sama_3035 membrane protein (RefSeq) (Shewanella amazonensis SB2B)
MSKASSGLLELHSAVLLFGGTALFSKLIPLGALDITVYRCAIAALVLALIVKATRHSLRL
GNKRDYGIALALGVIVSLHWVTYFASMQMSSVAIGMIAFFTYPVMTVLVEPLINGTRPHL
RDLVCGVAVLTGVALLIPEASLGNDITLGILVGVLSAALFTARNLLHKRYFAQYTGPQAM
FYQTLVAVLFLGSFVESTPPEVTSDVWQLLILLGVIFTATPHALFTSALRHLSAKTVGLV
SCLQPFYGTVLALLLLGETVNLSTLLGGLLVVSTAVYETAQSHRQQRQKKALD