Protein Info for Sama_3026 in Shewanella amazonensis SB2B

Name: miaA
Annotation: tRNA delta(2)-isopentenylpyrophosphate transferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01745: IPT" amino acids 6 to 59 (54 residues), 25.1 bits, see alignment E=1.1e-09 TIGR00174: tRNA dimethylallyltransferase" amino acids 7 to 294 (288 residues), 342.2 bits, see alignment E=1.2e-106 PF01715: IPPT" amino acids 41 to 283 (243 residues), 295.9 bits, see alignment E=2.6e-92

Best Hits

Swiss-Prot: 100% identical to MIAA_SHEAM: tRNA dimethylallyltransferase (miaA) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K00791, tRNA dimethylallyltransferase [EC: 2.5.1.75] (inferred from 100% identity to saz:Sama_3026)

MetaCyc: 64% identical to tRNA dimethylallyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6274 [EC: 2.5.1.75]

Predicted SEED Role

"tRNA dimethylallyltransferase (EC 2.5.1.75)" (EC 2.5.1.75)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SA22 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Sama_3026 tRNA delta(2)-isopentenylpyrophosphate transferase (RefSeq) (Shewanella amazonensis SB2B)
MTSLPKVLFLMGPTASGKTALALDMAEHHNCEIISVDSALIYRGMDIGTAKPTASELARA
PHKLIDILDPLESYSAADFRADAVREIEETLSRGKTPLLVGGTMMYFKTLLDGLSPLPSA
DDAVRAQIAAEVEARGWQALHDELRNIDPVSAERIHPNDPQRLSRAIEVYRISGKTLTEL
TKIKAESLPYHMVQFAIAPQDRTVLHGLIAKRFQQMLAEGFIGEVETLKARGDLHLELPS
MRCVGYRQAWQYLDGEFDHATMVEKAVAATRQLAKRQLTWLRGWPELHWLASGDEGNLDK
LVQQSR