Protein Info for Sama_3020 in Shewanella amazonensis SB2B

Annotation: ubiquinol-cytochrome c reductase, cytochrome b (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details amino acids 309 to 327 (19 residues), see Phobius details amino acids 344 to 362 (19 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details PF00033: Cytochrome_B" amino acids 26 to 212 (187 residues), 221.5 bits, see alignment E=1.3e-69 PF13631: Cytochrom_B_N_2" amino acids 94 to 264 (171 residues), 149.1 bits, see alignment E=1.9e-47 PF00032: Cytochrom_B_C" amino acids 279 to 380 (102 residues), 137.9 bits, see alignment E=2e-44

Best Hits

Swiss-Prot: 63% identical to CYB_ALLVD: Cytochrome b (petB) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: K00412, ubiquinol-cytochrome c reductase cytochrome b subunit [EC: 1.10.2.2] (inferred from 100% identity to saz:Sama_3020)

MetaCyc: 48% identical to cytochrome b (Acidithiobacillus ferrooxidans)
RXN-15829 [EC: 7.1.1.8]

Predicted SEED Role

"Ubiquinol--cytochrome c reductase, cytochrome B subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2 or 7.1.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SA16 at UniProt or InterPro

Protein Sequence (404 amino acids)

>Sama_3020 ubiquinol-cytochrome c reductase, cytochrome b (RefSeq) (Shewanella amazonensis SB2B)
MVKNIIDWIDARIPMTATYNRHVGQYATPKNFNFWYFFGSLALLVLVNQILTGIWLTMNY
VPTAEGAFASIEYIMRDVEYGWLLRYMHSTGASAFFVVVYLHMFRGLIYGSYQKPRELLW
LFGMLIFLVLMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPVIGDDLTLWIRGDYVVSGA
TLNRFFALHVIALPLVLVVLVFLHLIALHEVGSNNPDGIEIKKNKDENGWPVDGIPFHPY
YTVKDIMGVAGFLIVFCYVLFFMPEGGGYFLEKPNFEAANPMKTPEHIAPVWYFTPFYAI
LRAVPHKLGGVIMMGLSIAVLFLLPWLDRCKVKSVRYRSMIHKLNIAQFSVSFVVLGYLG
AVPASPALTIAAQVFTITYFGFFVALWVYSKNEKTKPVPARLTK