Protein Info for Sama_3016 in Shewanella amazonensis SB2B

Annotation: GGDEF domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 99 to 126 (28 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 177 to 203 (27 residues), see Phobius details amino acids 329 to 352 (24 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 211 to 371 (161 residues), 135.9 bits, see alignment E=5.5e-44 PF00990: GGDEF" amino acids 215 to 366 (152 residues), 131.7 bits, see alignment E=1.1e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_3016)

Predicted SEED Role

"response regulator receiver domain protein (CheY-like)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SA12 at UniProt or InterPro

Protein Sequence (385 amino acids)

>Sama_3016 GGDEF domain-containing protein (RefSeq) (Shewanella amazonensis SB2B)
MIIKPSSVNSMAFWGKRLLSYAKTGIEHCHGKTQERRLIQTNISVFIAVITILVFNLAFV
LLGNPGLMYSGLVQLPFLLLLPLVLWFNRKGRRHEATLTLFLLVMLDAVSALMLAQGVTL
GLQYYFLMFAVLPASYLDAKHWPTTLLLFLSNILLFGYFEVYGWQAHPSIAEVPTFTITL
LRIIMVGSCATTVLVVILISEYYAAQNEQELQYLADTDSLTGLPNRRAFMGRLERTIKDR
RSFSLLIIDVDHFKQINDTTGHQTGDAALQFLANQLNACIQGEDFAGRIGGEEFAMVQFC
ASPLEHLVRAESLRKTIASAHPDLGVGPVYLTVSIGVCMATPPVSLITLMAMADNALYEA
KRSGRNCVQVAAAKSESVPPWQAVT