Protein Info for Sama_2939 in Shewanella amazonensis SB2B

Annotation: tyrosine-specific transport protein, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 33 to 54 (22 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 148 to 165 (18 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details amino acids 275 to 298 (24 residues), see Phobius details amino acids 311 to 329 (19 residues), see Phobius details amino acids 335 to 354 (20 residues), see Phobius details amino acids 374 to 393 (20 residues), see Phobius details PF03222: Trp_Tyr_perm" amino acids 4 to 389 (386 residues), 330.7 bits, see alignment E=1.4e-102 PF01490: Aa_trans" amino acids 6 to 234 (229 residues), 47.6 bits, see alignment E=1e-16

Best Hits

KEGG orthology group: K03834, tyrosine-specific transport protein (inferred from 100% identity to saz:Sama_2939)

Predicted SEED Role

"Tyrosine-specific transport protein" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S9T5 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Sama_2939 tyrosine-specific transport protein, putative (RefSeq) (Shewanella amazonensis SB2B)
MNLKTLGSIAIVAGTAIGAGMLALPLATAALGVIPALLLLLVVWAISAYTSLLMLEINLR
SGVGDNVHAITGKTLGKKGQLIQGASFLSLLYALTAAYLTGGSSLLVHRMESVFSINLDG
QLAVLLFTLVLGSVAALGVSWVDKLSRLLFSLMVVLLVLVVGFLLPEIRPSVIAADAFEK
VSANAWMAAIPVVFTSFGFHVCIATLVRYLDGDAVNLRKVLLIGSTIPLVCYILWLLVTL
GTVGGDEIATFNGALPKLISALQELAAHPVVGQSIAVFADLALVTSFLGVTMSLFDFLAE
MTRSKGGIGGRLQTWIITFLPPLLCALFVPEGFVAVLGFAAIPLVFMIIFLPIAMALNQR
AQYRDGYQVSGGKLALSLIGVAGVAIIAAQLWVAL