Protein Info for Sama_2935 in Shewanella amazonensis SB2B

Annotation: Na+/H+ antiporter family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 76 to 102 (27 residues), see Phobius details amino acids 125 to 153 (29 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 244 to 274 (31 residues), see Phobius details amino acids 288 to 311 (24 residues), see Phobius details amino acids 390 to 416 (27 residues), see Phobius details amino acids 423 to 441 (19 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 13 to 225 (213 residues), 56.9 bits, see alignment E=1e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_2935)

Predicted SEED Role

"Methionine transporter MetT" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S9T1 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Sama_2935 Na+/H+ antiporter family protein (RefSeq) (Shewanella amazonensis SB2B)
MNQSPDTQGNASAASFVALLPLFLFLALFIGAGVYFTSQGVDFAFYQLPSVVAILPAIVL
ALLLSKQKLNQAIDTFIGGIGHSNIIAMCLIYLLAGAFASVAKATGGVDATVALGLSLIP
SDLLLPGFFVIAAFIATAMGTSMGTIAAVAPIALGVSQEADISLPLMAGAIISGALFGDN
LSIISDTTIAATRTQGCNMKDKFRENLIFALPASLITLLAFTLAGQGEANVAPQSVDFVK
VLPYLCILFLAVAGLNVFVVLGIGILLAGLVGMFTTDYSWVSFSKDIYAGFGNMQEIFIL
SMLVGGLAALMQQQGGLAFVSRFIEGLIARFSKAKGEASCRAAELGMAGIVSLTNACVAN
NTVSIVISGDIARDLAQKHGVSAKRSASVLDIFSCIVQGLIPYGAQALLIGATFAITPLE
AVSYAWYCMILALVAVLIVTFRQRH