Protein Info for Sama_2908 in Shewanella amazonensis SB2B

Annotation: ABC transporter, ATP-binding/permease protein, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 593 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 282 to 307 (26 residues), see Phobius details TIGR02204: ABC transporter, permease/ATP-binding protein" amino acids 18 to 589 (572 residues), 804.9 bits, see alignment E=2.3e-246 PF00664: ABC_membrane" amino acids 35 to 302 (268 residues), 163 bits, see alignment E=1.2e-51 PF00005: ABC_tran" amino acids 369 to 518 (150 residues), 111.2 bits, see alignment E=6.2e-36

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to saz:Sama_2908)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S9Q4 at UniProt or InterPro

Protein Sequence (593 amino acids)

>Sama_2908 ABC transporter, ATP-binding/permease protein, putative (RefSeq) (Shewanella amazonensis SB2B)
MPDTLATNNQATTASQGNVVAWLGSFLRPYKLRVITALICLLIGSLAWLALGQGVKLIVD
EGFVAGDAARLNQLVWLLVGIAAISSSAVFCRFYLMSWLGERVSNDIRARVYDNLLTLPP
AFYAKLRTGEVISRFTADSTLLQTVIGSSFSMALRSFVSVLGGIAMMAITSVKLTALVLV
AVPAVLVPILIFGRKVRTLSRDSQDRVADLGAYIDESLHEIHTVQSYTHEQVDRDKFAGL
LGKVLGSAGRRIQFRALLIAGVMFLTIAAIALMIWVGARDVMIGAISAGELSAFLFYALL
VAGATATISEVIGDVQRASGAAERLKELSEAVSEVPQARHPVALPAKLSGDIRIEGLSFC
YPGTDVRALDEISVHIRPGEKVALVGESGAGKSTLFQLLGRFYAPDSGTIYLDDTDIANA
DLQALRRAFALVPQESVIFADSVLENVRYGKVDATLDEVKAACVAARAHDFIEAMPEGYH
SYLGERGVKLSGGQKQRIAIARAILASRPVLLLDEATSALDAVSERYVKEALDTLICGRT
SLIIAHRLATVINADRILVMDKGKIIAQGSHTELLESSQQYREFASLQLLTEA