Protein Info for Sama_2897 in Shewanella amazonensis SB2B

Annotation: long-chain-fatty-acid--CoA ligase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 transmembrane" amino acids 239 to 259 (21 residues), see Phobius details amino acids 273 to 289 (17 residues), see Phobius details PF00501: AMP-binding" amino acids 21 to 395 (375 residues), 298 bits, see alignment E=9.5e-93 PF13193: AMP-binding_C" amino acids 446 to 523 (78 residues), 76.1 bits, see alignment E=3.4e-25

Best Hits

KEGG orthology group: K01897, long-chain acyl-CoA synthetase [EC: 6.2.1.3] (inferred from 100% identity to saz:Sama_2897)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.3

Use Curated BLAST to search for 6.2.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S9P3 at UniProt or InterPro

Protein Sequence (531 amino acids)

>Sama_2897 long-chain-fatty-acid--CoA ligase (RefSeq) (Shewanella amazonensis SB2B)
MLNNDNNQLDLNEYASLIDLFTKACKRFGDKPAFACLGKSHSFNEIDKLSTDFAAFLQHH
TQLQPGDKVAIQLPNLTQFVIAAYGVLKAGMVLVNTNPLYTERELIHQFKDSGAKVLVVL
SDLLPTLAKVVAETPIELVISTHALDLVSPQIQPKTGLKNIEFLKALNLGSQESWQPVAA
NHSTLAALQYTGGTTGLSKGAMLSHGNLIANALQCRDRLANVITPGEDIFVAPLPIYHIY
AFLVNLVLFVEQGACSVLIPNPRDIPSLIKTLAKYPFTGFAGLNTLFVALCHQEEFRALD
FSHLKLTISGGTALTEAAAGLWQQTTGCTISEGYGLSETSPVITLNQPGAERLGTIGRPV
LATEVQILDEDETPVPMGQAGELAVRGPQVMSGYWQQAGETERVFSKDGFFKTGDIAIAE
PDGCYRIVDRKKDMIIVSGFNVYPNEVENVLASHPAVLECAVIGVADERSGEAVKAVIVL
KPSVEADDARAAITAHCQANLAGYKQPRHIEFVASLPKSTVGKILRRALRS