Protein Info for Sama_2871 in Shewanella amazonensis SB2B

Annotation: response regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 196 to 217 (22 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details amino acids 346 to 364 (19 residues), see Phobius details amino acids 379 to 396 (18 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 50 to 182 (133 residues), 130.5 bits, see alignment E=6.4e-42 PF07695: 7TMR-DISM_7TM" amino acids 194 to 398 (205 residues), 170.9 bits, see alignment E=5.4e-54 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 404 to 562 (159 residues), 157.2 bits, see alignment E=1.6e-50 PF00990: GGDEF" amino acids 407 to 559 (153 residues), 154.6 bits, see alignment E=3e-49

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_2871)

Predicted SEED Role

"Signaling protein with a acyltransferase and GGDEF domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S9L7 at UniProt or InterPro

Protein Sequence (564 amino acids)

>Sama_2871 response regulator (RefSeq) (Shewanella amazonensis SB2B)
MIRLLFIWLACLPVFSGALYAASLPVESNAPSKYALAVAEARTALLPLTPYLSLLEDSGG
QLSFDDVRQQAEQNKFIPLKGSANFGFSPSTWWVRVSVHNPADEARQFYLRQDYPLIDFL
DLWQPSADGWLHTATGDRRAFHSRLLDLRTFVFPLTLAPGETQTLYLRFETQGSLNIGLA
LYAPSELISQVTWEYLSLGIYYGGFIVLLVYNLIIFLTVRERAFIFYVLYVLSYGLYMSV
HNGLSFQYLWPENSWMANKSLLLLLALSLFGALRFTREILGLAQILPGADRLAARVEWGC
VLGLILAPILSYHLVVLLLSVLTTFICIQLLVVGVMALMKGSRPARFYLVAFSALLLGAF
VYMLKSFGVLPHNAFTQNAFQLGSLVEMVLLSLALGSRMQDIKRRNHIDVLTGLYNRRFF
DEQLQQEYLKACRRHQPLSLLVLDIDYFKQFNDSRGHAEGDKALQLVADILAGTVQKPGM
ACRYGGEEFALILPETSAGEAMQLAERIREKVVRDTKERIELTVSIGCSEFDAKQHLSGF
ALFEAADEALYRAKADGRNCVRAC