Protein Info for Sama_2815 in Shewanella amazonensis SB2B

Annotation: phosphotransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF01636: APH" amino acids 42 to 255 (214 residues), 87.2 bits, see alignment E=7.6e-29

Best Hits

KEGG orthology group: K07102, (no description) (inferred from 100% identity to saz:Sama_2815)

Predicted SEED Role

"Phosphotransferase involved in threonylcarbamoyladenosine t(6)A37 formation in tRNA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S9G1 at UniProt or InterPro

Protein Sequence (348 amino acids)

>Sama_2815 phosphotransferase (RefSeq) (Shewanella amazonensis SB2B)
MLAIIKQFFAKSHGTTVSDSRFLALNHWLSNTFGEPLSPVLISGDASFRRYFRAVHQGRA
MVIMDTPVALIPTEPFVAVRNAYAASGLPVPGIIAKDDEQGFMALEDFGDVQLLSLLNSQ
SVRHWYPRALALLPGIAAVTQTVLGPLPDYDDAFVRRELGIFTEWLLGTHLKLELTSDEE
AIIADAFDMLTQNALEQPKVGMHRDFHSRNLMVVDGELKLLDFQDAVLGPVTYDAVSLLR
DCYIRWSEDLVDDMLVEFFVLAHEHALVPPHTDMVQFRRWFELMGLQRHIKAAGIFARLN
HRDGKAGYLKDIPLTMHYIRDVAVRYKELGDFAQFIMRRVMPALEAGA