Protein Info for Sama_2792 in Shewanella amazonensis SB2B

Annotation: acetyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 15 to 150 (136 residues), 44.2 bits, E=8.4e-15
• PF13420: Acetyltransf_4
  • amino acids 22 to 168 (147 residues), 53.2 bits, E=9.2e-18
• PF00583: Acetyltransf_1
  • amino acids 47 to 149 (103 residues), 77.3 bits, E=3e-25
• PF13673: Acetyltransf_10
  • amino acids 47 to 150 (104 residues), 33.7 bits, E=8e-12
• PF13508: Acetyltransf_7
  • amino acids 64 to 150 (87 residues), 59.4 bits, E=9.3e-20

Best Hits

Swiss-Prot: 50% identical to AAAT_ECOLI: L-amino acid N-acetyltransferase AaaT (aaaT) from Escherichia coli (strain K12)

KEGG orthology group: K03825, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to saz:Sama_2792)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

See A1S9D8 at UniProt or InterPro

Protein Sequence (178 amino acids)

>Sama_2792 acetyltransferase (RefSeq) (Shewanella amazonensis SB2B)
MSAQSPSIYRTTDGRIQVRHSDANDIGAIRAIYSQPSCFANTLQHPFPSLEKWQRRLGDL
PDNCYSLVAEIDGEIVGQAGMEVFANPRRKHVANLGMAVSEDYQGIGVGSALLAAMMELA
HNWLAVRRIELEVYTDNHAAIKLYKRHGFVIEGEAIGYAFRGGEYVDAFLMASCRDFG