Protein Info for Sama_2782 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 19 to 41 (23 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details PF02517: Rce1-like" amino acids 128 to 225 (98 residues), 64 bits, see alignment E=6.5e-22

Best Hits

KEGG orthology group: K07052, (no description) (inferred from 100% identity to saz:Sama_2782)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S9C8 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Sama_2782 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MDENTRTLKVHLRQLRAVLLKMLVAALFIGGAIALFRFGLLPLLGKLLSLGEGELAALRR
GGILVCLLLGYWGYVHVAEKRRPTELALRPASIALGALLGVAMIALASWLLFATGVYQLN
EYRGFSSALFGVAGVIIVAATIEEVVFRGVMFQALESAWGTVAALWLQSLIFSVLHIANL
DSNLGTPELVVTVISGTLIGAFWTVLFVQSRNIWVVAANHAAWNFAVLLTGLPLSGLDDW
RALAPLESSYIGPNWLSGGTVGPEDSIVTVVLVALALIAMLLWLGKRGRFLAPVQAKPLS
PIASSAGVG