Protein Info for Sama_2762 in Shewanella amazonensis SB2B

Annotation: putative diguanylate phosphodiesterase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 678 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 123 to 139 (17 residues), see Phobius details amino acids 160 to 188 (29 residues), see Phobius details amino acids 206 to 229 (24 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details amino acids 310 to 332 (23 residues), see Phobius details amino acids 348 to 372 (25 residues), see Phobius details PF02378: PTS_EIIC" amino acids 18 to 315 (298 residues), 57.8 bits, see alignment E=1e-19 PF00563: EAL" amino acids 430 to 653 (224 residues), 192.7 bits, see alignment E=7e-61

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_2762)

Predicted SEED Role

"FOG: EAL domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S9A8 at UniProt or InterPro

Protein Sequence (678 amino acids)

>Sama_2762 putative diguanylate phosphodiesterase (RefSeq) (Shewanella amazonensis SB2B)
MQVNFQLFDRSFLLAVRESFIALLPFLLINALLALFPVLATVLAPELSVYDAFHWFEGIS
DTLGRLFPLLAMLSLSYHFAKYLDISAVASATLSLCIIFSLHVHTSGGLVFSDYLLEVLG
DPRMVITPILAAYIMRHFLKFPQLHMVRSAEISAYLSQHLNLIIPMVLTYTLVVLILKAM
SLLLVLGISPMVDAVGEFGPMGQLVFRVLLTHMLWCFGVHGDNAFLLLIGDDNGLRYLAP
NLTFSEFMDLFVLLGGSGATIPLLIAIFLESRDEQSRHLAKIAVPFSVVNINEILIYGLP
IVFNLRLAIPFVLLPCLNVLIAWMAISAGFLSFDGKPFPWVTPLFLNGWIASGGFTVVAL
QLFLVTVGVFIYRPFIRKYSALADTNQYDRELIKRTELQTDIERMAERQYSRNQSETLAA
SRNLERTVREVLSGELLVHYQPKLKLPGQEVVGFEALLRLKDADGNIKGPWFIDNFQRAG
YSHVIDRFVINTVAEDLRRWQAAGFSPKVSINLDPNNLNDVLMLDRLRTTLGEFAHQVEV
EILERAFMRDLQGINRAIAQLQALGFRFLLDDFGTGFSSLSLLTQITVDGIKLDRSILGK
TDTDQGRVLYRQICQLCKSLGFQLVAEGVETPSEASFVADAGVDYVQGWLYAKALPQARA
MEYALNHGKITPNDLDTI