Protein Info for Sama_2758 in Shewanella amazonensis SB2B

Annotation: erythrose 4-phosphate dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00044: Gp_dh_N
  • amino acids 2 to 104 (103 residues), 107.8 bits, E=3.2e-35
• TIGR01532: erythrose-4-phosphate dehydrogenase
  • amino acids 3 to 327 (325 residues), 532.3 bits, E=2.4e-164
• PF02800: Gp_dh_C
  • amino acids 159 to 315 (157 residues), 183.5 bits, E=2.2e-58

Best Hits

Swiss-Prot: 100% identical to E4PD_SHEAM: D-erythrose-4-phosphate dehydrogenase (epd) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 100% identity to saz:Sama_2758)

MetaCyc: 64% identical to D-erythrose-4-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Erythrose-4-phosphate dehydrogenase. [EC: 1.2.1.72]

Predicted SEED Role

"D-erythrose-4-phosphate dehydrogenase (EC 1.2.1.72)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.2.1.72)

MetaCyc Pathways

• gluconeogenesis I (13/13 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• Bifidobacterium shunt (13/15 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• heterolactic fermentation (15/18 steps found)
• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis III (from glucose) (9/11 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• homolactic fermentation (9/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• glycolysis IV (7/10 steps found)
• gluconeogenesis III (8/12 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (8/12 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• glycerol degradation to butanol (9/16 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis
• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.12

Use Curated BLAST to search for 1.2.1.12 or 1.2.1.72

Sequence Analysis Tools

See A1S9A4 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Sama_2758 erythrose 4-phosphate dehydrogenase (RefSeq) (Shewanella amazonensis SB2B)
MIRVAINGYGRIGRSVLRALYESGKRGQMQLVAINELAKPEAIVHLTNYDTTHGRFHTRA
SLDEGMMHLGNDAIRLLAIEDAAALPWQALDVDLVFECTGALNDRQSAEAHITAGARKVL
ISHPSSADVDATIVYGVNDASLKATDTVVSNASCTTNCLVPVIDVLDRHFGVKSGAITTI
HSAMNDQQVIDAYHDDLRRTRAASQSIIPVDTKLARGIERILPQMKDKFEAISVRVPTIN
VTAIDLSVTLDTRVDIATVNAALKAAADGSASGILGYTDEPLVSCDFNHDPRSSVVDGTQ
TRVSAGHLVKMLLWCDNEWGFANRMLDTALAMAATQAE